PDB entry 1n90

View 1n90 on RCSB PDB site
Description: following the c heme reduction in nitrite reductase from pseudomonas aeruginosa
Deposited on 1998-09-04, released 1999-06-15
The last revision prior to the SCOP 1.55 freeze date was dated 1999-09-15, with a file datestamp of 1999-09-14.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.204
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n90A (A:)
    aaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkpltp
    ditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewgmpemr
    eswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidtgyavhisr
    msasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyedrytiagay
    wppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivnvketgkvl
    lvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrrlsalvdvg
    ktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelqgqgggslf
    ikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgegakrvvqpe
    ynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyntqhdvy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n90B (B:)
    kaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkplt
    pditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewgmpem
    reswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidtgyavhis
    rmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyedrytiaga
    ywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivnvketgkv
    llvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrrlsalvdv
    gktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelqgqgggsl
    fikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgegakrvvqp
    eynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyntqhdvy