PDB entry 1n8s

View 1n8s on RCSB PDB site
Description: Structure of the pancreatic lipase-colipase complex
Class: hydrolase
Keywords: HYDROLASE, pancreas
Deposited on 2002-11-21, released 2002-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3.04 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Triacylglycerol lipase, pancreatic
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n8sa1, d1n8sa2
  • Chain 'C':
    Compound: colipase II
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n8sc1, d1n8sc2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n8sA (A:)
    kevcyerlgcfsddspwsgiterplhilpwspkdvntrfllytnenpnnfqevaadsssi
    sgsnfktnrktrfiihgfidkgeenwlanvcknlfkvesvncicvdwkggsrtgytqasq
    nirivgaevayfveflqsafgyspsnvhvighslgahaageagrrtngtigritgldpae
    pcfqgtpelvrldpsdakfvdvihtdgapivpnlgfgmsqvvghldffpnggvempgckk
    nilsqivdidgiwegtrdfaacnhlrsykyytdsivnpdgfagfpcasynvftankcfpc
    psggcpqmghyadrypgktndvgqkfyldtgdasnfarwrykvsvtlsgkkvtghilvsl
    fgnkgnskqyeifkgtlkpdsthsnefdsdvdvgdlqmvkfiwynnvinptlprvgaski
    ivetnvgkqfnfcspetvreevlltltpc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n8sC (C:)
    vpdprgiiinldegelclnsaqcksnccqhdtilsllrcalkarensecsaftlygvyyk
    cpcergltcegdkslvgsitntnfgichnvgrsds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n8sC (C:)
    giiinldegelclnsaqcksnccqhdtilsllrcalkarensecsaftlygvyykcpcer
    gltcegdkslvgsitntnfgichnv