PDB entry 1n8q

View 1n8q on RCSB PDB site
Description: lipoxygenase in complex with protocatechuic acid
Deposited on 2002-11-21, released 2003-06-03
The last revision prior to the SCOP 1.71 freeze date was dated 2004-02-10, with a file datestamp of 2004-02-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.192
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n8qA (A:)
    mlggllhrghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvsl
    qlisatkadangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknf
    mqtefflvsltledipnhgsihfvcnswiynaklfksdriffanqtylpsetpaplvkyr
    eeelhnlrgdgtgerkeweriydydvyndlgdpdkgenharpvlggndtfpyprrgrtgr
    kptrkdpnsesrsndvylprdeafghlkssdfltyglksvsqnvlpllqsafdlnftpre
    fdsfdevhglysggiklptdiiskisplpvlkeifrtdgeqalkfpppkviqvsksawmt
    deefaremlagvnpnlirclkdfpprskldsqvygdhtsqitkehlepnlegltvdeaiq
    nkrlflldhhdpimpylrrinatstkayatrtilflkndgtlrplaielslphpqgdqsg
    afsqvflpadegvessiwllakayvvvndscyhqlvshwlnthavvepfiiatnrhlsvv
    hpiykllhphyrdtmninglarlslvndggvieqtflwgrysvemsavvykdwvftdqal
    padlikrgmaiedpscphgirlviedypytvdgleiwdaiktwvheyvflyyksddtlre
    dpelqacwkelvevghgdkknepwwpkmqtreelveacaiiiwtasalhaavnfgqypyg
    glilnrptlsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidlsvieilsrhasde
    vylgerdnpnwtsdtraleafkrfgnklaqienklsernndeklrnrcgpvqmpytlllp
    sskegltfrgipnsisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n8qA (A:)
    ghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvslqlisatka
    dangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknfmqtefflv
    sltledipnhgsihfvcnswiynaklfksdriffanqtylpsetpaplvkyreeelhnlr
    gdgtgerkeweriydydvyndlgdpdkgenharpvlggndtfpyprrgrtgrkptrkdpn
    sesrsndvylprdeafghlkssdfltyglksvsqnvlpllqsafdlnftprefdsfdevh
    glysggiklptdiiskisplpvlkeifrtdgeqalkfpppkviqvsksawmtdeefarem
    lagvnpnlirclkdfpprskldsqvygdhtsqitkehlepnlegltvdeaiqnkrlflld
    hhdpimpylrrinatstkayatrtilflkndgtlrplaielslphpqgdqsgafsqvflp
    adegvessiwllakayvvvndscyhqlvshwlnthavvepfiiatnrhlsvvhpiykllh
    phyrdtmninglarlslvndggvieqtflwgrysvemsavvykdwvftdqalpadlikrg
    maiedpscphgirlviedypytvdgleiwdaiktwvheyvflyyksddtlredpelqacw
    kelvevghgdkknepwwpkmqtreelveacaiiiwtasalhaavnfgqypygglilnrpt
    lsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidlsvieilsrhasdevylgerdn
    pnwtsdtraleafkrfgnklaqienklsernndeklrnrcgpvqmpytlllpsskegltf
    rgipnsisi