PDB entry 1n8n

View 1n8n on RCSB PDB site
Description: Crystal structure of the Au3+ complex of AphA class B acid phosphatase/phosphotransferase from E. coli at 1.69 A resolution
Class: hydrolase
Keywords: Class B acid phosphatase, DDDD acid phosphatase, metallo-enzyme, HYDROLASE
Deposited on 2002-11-21, released 2004-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.179
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Class B acid phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: aphA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n8na_
  • Heterogens: AU3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n8nA (A:)
    sspsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgk
    ktfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptkte
    tvsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvga
    rgirilrasnstykplpqagafgeevivnsey
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n8nA (A:)
    splnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkktf
    spesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetvs
    ktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgargi
    rilrasnstykplpqagafgeevivnsey