PDB entry 1n8l

View 1n8l on RCSB PDB site
Description: The NMR solution structure of the Type I rat fatty acid synthase ACP domain.
Deposited on 2002-11-21, released 2003-06-10
The last revision prior to the SCOP 1.65 freeze date was dated 2003-06-10, with a file datestamp of 2003-06-10.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1n8la_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n8lA (A:)
    gdgeaqrdlvkavahilgirdlaginldssladlgldslmgvevrqilerehdlvlpire
    vrqltlrklqemsskagsdtelaapkskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n8lA (A:)
    gdgeaqrdlvkavahilgirdlaginldssladlgldslmgvevrqilerehdlvlpire
    vrqltlrklqemsska