PDB entry 1n8f

View 1n8f on RCSB PDB site
Description: Crystal structure of E24Q mutant of phenylalanine-regulated 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase) from Escherichia Coli in complex with Mn2+ and PEP
Class: metal binding protein
Keywords: (Beta/Alpha)8 Barrel, METAL BINDING PROTEIN
Deposited on 2002-11-20, released 2003-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.209
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DAHP Synthetase
    Species: Escherichia coli [TaxId:562]
    Gene: aroG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AB91 (Start-349)
      • engineered (23)
    Domains in SCOPe 2.06: d1n8fa_
  • Chain 'B':
    Compound: DAHP Synthetase
    Species: Escherichia coli [TaxId:562]
    Gene: aroG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AB91 (Start-349)
      • engineered (23)
    Domains in SCOPe 2.06: d1n8fb_
  • Chain 'C':
    Compound: DAHP Synthetase
    Species: Escherichia coli [TaxId:562]
    Gene: aroG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AB91 (Start-349)
      • engineered (23)
    Domains in SCOPe 2.06: d1n8fc_
  • Chain 'D':
    Compound: DAHP Synthetase
    Species: Escherichia coli [TaxId:562]
    Gene: aroG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AB91 (Start-349)
      • engineered (23)
    Domains in SCOPe 2.06: d1n8fd_
  • Heterogens: MN, SO4, PEP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n8fA (A:)
    mnyqnddlrikeikellppvallqkfpatenaantvaharkaihkilkgnddrllvvigp
    csihdpvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqin
    dglriarkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasgls
    cpvgfkngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepn
    ysakhvaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvm
    veshlvegnqslesgeplaygksitdacigwedtdallrqlanavkarrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n8fA (A:)
    lrikeikellppvallqkfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
    aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
    kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
    gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
    evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
    gnqslesgeplaygksitdacigwedtdallrqlanavkarrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n8fB (B:)
    mnyqnddlrikeikellppvallqkfpatenaantvaharkaihkilkgnddrllvvigp
    csihdpvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqin
    dglriarkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasgls
    cpvgfkngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepn
    ysakhvaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvm
    veshlvegnqslesgeplaygksitdacigwedtdallrqlanavkarrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n8fB (B:)
    lrikeikellppvallqkfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
    aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
    kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
    gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
    evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
    gnqslesgeplaygksitdacigwedtdallrqlanavkarrg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n8fC (C:)
    mnyqnddlrikeikellppvallqkfpatenaantvaharkaihkilkgnddrllvvigp
    csihdpvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqin
    dglriarkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasgls
    cpvgfkngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepn
    ysakhvaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvm
    veshlvegnqslesgeplaygksitdacigwedtdallrqlanavkarrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n8fC (C:)
    lrikeikellppvallqkfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
    aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
    kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
    gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
    evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
    gnqslesgeplaygksitdacigwedtdallrqlanavkarrg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n8fD (D:)
    mnyqnddlrikeikellppvallqkfpatenaantvaharkaihkilkgnddrllvvigp
    csihdpvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqin
    dglriarkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasgls
    cpvgfkngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepn
    ysakhvaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvm
    veshlvegnqslesgeplaygksitdacigwedtdallrqlanavkarrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n8fD (D:)
    lrikeikellppvallqkfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
    aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
    kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
    gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
    evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
    gnqslesgeplaygksitdacigwedtdallrqlanavkarrg