PDB entry 1n89

View 1n89 on RCSB PDB site
Description: Solution structure of a liganded type 2 wheat non-specific Lipid Transfer Protein
Class: lipid transport
Keywords: lipid transfer protein, LIPID TRANSPORT
Deposited on 2002-11-20, released 2003-03-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lipid transfer protein
  Species: Triticum turgidum [TaxId:4567]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P82900 (0-66)
  Domains in SCOPe 2.08: d1n89a_
• Heterogens: PGM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1n89A (A:)
  acqasqlavcasailsgakpsgeccgnlraqqgcfcqyakdptygqyirsphardtltsc
  glavphc