PDB entry 1n88

View 1n88 on RCSB PDB site
Description: NMR structure of the ribosomal protein L23 from Thermus thermophilus.
Class: translation
Keywords: NMR spectroscopy, protein structure, L23, ribosome, translation
Deposited on 2002-11-20, released 2003-06-10
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribosomal protein l23
  Species: Thermus thermophilus [TaxId:274]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9RA57 (0-95)
  Domains in SCOPe 2.01: d1n88a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1n88A (A:)
  mktaydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvr
  gkkkrlgrylgkrpdrkkaivqvapgqkiealegli