PDB entry 1n88

View 1n88 on RCSB PDB site
Description: NMR structure of the ribosomal protein L23 from Thermus thermophilus.
Class: translation
Keywords: NMR spectroscopy, protein structure, L23, ribosome, translation
Deposited on 2002-11-20, released 2003-06-10
The last revision prior to the SCOP 1.75 freeze date was dated 2003-06-10, with a file datestamp of 2007-06-04.
Experiment type: NMR29
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein l23
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1n88a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n88A (A:)
    mktaydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvr
    gkkkrlgrylgkrpdrkkaivqvapgqkiealegli