PDB entry 1n88

View 1n88 on RCSB PDB site
Description: nmr structure of the ribosomal protein l23 from thermus thermophilus.
Deposited on 2002-11-20, released 2003-06-10
The last revision prior to the SCOP 1.69 freeze date was dated 2003-06-10, with a file datestamp of 2003-06-10.
Experiment type: NMR29
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1n88a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1n88A (A:)
  mktaydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvr
  gkkkrlgrylgkrpdrkkaivqvapgqkiealegli