PDB entry 1n87

View 1n87 on RCSB PDB site
Description: Solution structure of the U-box of Prp19
Class: ligase/cell cycle
Keywords: Ubiquitin ligase, E3 ligase, U-box, LIGASE/CELL CYCLE COMPLEX
Deposited on 2002-11-19, released 2003-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-mRNA splicing factor PRP19
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: Prp19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1n87a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1n87A (A:)
mlcaisgkvprrpvlspksrtifekslleqyvkdtgndpitneplsieeiveivps