PDB entry 1n7x

View 1n7x on RCSB PDB site
Description: human serum transferrin, n-lobe y45e mutant
Class: transport protein
Keywords: iron transport, transport protein
Deposited on 2002-11-18, released 2003-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.193
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serotransferrin
    Species: Homo sapiens [TaxId:9606]
    Gene: TF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02787 (Start-330)
      • engineered (44)
    Domains in SCOPe 2.06: d1n7xa_
  • Heterogens: CO3, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n7xA (A:)
    vpdktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkaseldciraiaaneadav
    tldaglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkscht
    glgrsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcs
    tlnqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykd
    chlaqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsah
    gflkvpprmdakmylgyeyvtairnlregtc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n7xA (A:)
    dktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkaseldciraiaaneadavtl
    daglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtgl
    grsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstl
    nqyfgysgafkclkdgagdvafvkhstifenlankadrdqyellcldntrkpvdeykdch
    laqvpshtvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgf
    lkvpprmdakmylgyeyvtairnlregtc