PDB entry 1n7t

View 1n7t on RCSB PDB site
Description: ERBIN PDZ domain bound to a phage-derived peptide
Class: signaling protein
Keywords: pdz domain, c-terminal peptide complex, high affnity ligand, SIGNALING PROTEIN
Deposited on 2002-11-16, released 2003-01-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 99-mer peptide of densin-180-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ERBIN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96RT1 (4-102)
      • cloning artifact (0-3)
    Domains in SCOPe 2.08: d1n7ta1, d1n7ta2
  • Chain 'B':
    Compound: phage-derived peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1N7T (0-6)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n7tA (A:)
    gshmghelakqeirvrvekdpelgfsisggvggrgnpfrpdddgifvtrvqpegpaskll
    qpgdkiiqangysfiniehgqavsllktfqntveliivrevss
    

  • Chain 'B':
    No sequence available.