PDB entry 1n7r

View 1n7r on RCSB PDB site
Description: Streptococcus pneumoniae Hyaluronate Lyase W291A/W292A/F343V Mutant complex with hexasaccharide hyaluronan
Class: lyase
Keywords: protein mutant, LYASE
Deposited on 2002-11-16, released 2002-12-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.177
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hyaluronidase
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed):
    • GB AAA53685 (0-720)
      • engineered (121-122)
      • engineered (173)
      • see remark 999 (561)
    Domains in SCOPe 2.06: d1n7ra1, d1n7ra2, d1n7ra3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n7rA (A:)
    vkdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwekf
    snyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksivg
    naadyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpvkalggn
    lvdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytgayg
    nvlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisrans
    eghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmqsl
    lsdagvasvprtsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgwyt
    sdgmfylyngdlshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtskldda
    natatmdftnwnqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpykv
    yvndkeaslteqekdypetqsvflessdskknigyfffkkssismskalqkgawkdineg
    qsdkevenefltisqahkqngdsygymlipnvdratfnqmikelessliennetlqsvyd
    akqgvwgivkyddsvstisnqfqvlkrgvytirkegdeykiayynpetqesapdqevfkk
    l