PDB entry 1n7m

View 1n7m on RCSB PDB site
Description: Germline 7G12 with N-methylmesoporphyrin
Class: immune system
Keywords: immune system
Deposited on 2002-11-15, released 2003-02-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.22
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Germline Metal Chelatase Catalytic Antibody, chain H
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1N7M (0-212)
    Domains in SCOPe 2.03: d1n7mh1, d1n7mh2
  • Chain 'L':
    Compound: Germline Metal Chelatase Catalytic Antibody, chain L
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1n7ml1, d1n7ml2
  • Heterogens: MMP, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n7mH (H:)
    elvmtqtpkfmstsvgdrvsitckasqnvgtavawyqqkpgqspklliysasnrytgvpd
    rftgsgsgtdftltisnmqsedladyfcqqyssypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n7mL (L:)
    qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
    nekfkskatltvdkpsstaymqlssltsedsavyyctrrdsdywgagttvtvssastkgp
    svfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkvepks