PDB entry 1n7k

View 1n7k on RCSB PDB site
Description: Unique tetrameric structure of deoxyribose phosphate aldolase from Aeropyrum pernix
Class: lyase
Keywords: ALDOLASE, A.pernix, TETRAMER, ALPHA-BETA TIM BARREL, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, LYASE
Deposited on 2002-11-15, released 2003-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.224
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyribose-phosphate aldolase
    Species: Aeropyrum pernix [TaxId:56636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n7ka_
  • Chain 'B':
    Compound: deoxyribose-phosphate aldolase
    Species: Aeropyrum pernix [TaxId:56636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n7kb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n7kA (A:)
    psardilqqgldrlgspedlasridstllsprateedvrnlvreasdygfrcavltpvyt
    vkisglaeklgvklcsvigfplgqaplevklveaqtvleagateldvvphlslgpeavyr
    evsgivklaksygavvkvileaplwddktlsllvdssrragadivktstgvytkggdpvt
    vfrlaslakplgmgvkasggirsgidavlavgagadiigtssavkvlesfkslv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n7kB (B:)
    psardilqqgldrlgspedlasridstllsprateedvrnlvreasdygfrcavltpvyt
    vkisglaeklgvklcsvigfplgqaplevklveaqtvleagateldvvphlslgpeavyr
    evsgivklaksygavvkvileaplwddktlsllvdssrragadivktstgvytkggdpvt
    vfrlaslakplgmgvkasggirsgidavlavgagadiigtssavkvlesfkslv