PDB entry 1n7h

View 1n7h on RCSB PDB site
Description: Crystal Structure of GDP-mannose 4,6-dehydratase ternary complex with NADPH and GDP
Class: lyase
Keywords: Rossmann fold, SDR, short-chain dehydrogenase/reductase
Deposited on 2002-11-14, released 2003-01-07
The last revision prior to the SCOP 1.73 freeze date was dated 2003-01-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-D-mannose-4,6-dehydratase
    Species: Arabidopsis thaliana
    Gene: mur1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1n7ha_
  • Chain 'B':
    Compound: GDP-D-mannose-4,6-dehydratase
    Species: Arabidopsis thaliana
    Gene: mur1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1n7hb_
  • Heterogens: NDP, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n7hA (A:)
    masenngsrsdsesitapkadstvveprkialitgitgqdgsyltefllgkgyevhglir
    rssnfntqrinhiyidphnvnkalmklhyadltdasslrrwidvikpdevynlaaqshva
    vsfeipdytadvvatgalrlleavrshtidsgrtvkyyqagssemfgstpppqsettpfh
    prspyaaskcaahwytvnyreayglfacngilfnhesprrgenfvtrkitralgrikvgl
    qtklflgnlqasrdwgfagdyveamwlmlqqekpddyvvateeghtveefldvsfgylgl
    nwkdyveidqryfrpaevdnlqgdaskakevlgwkpqvgfeklvkmmvdedlelakrekv
    lvdagymdakqqplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n7hA (A:)
    rkialitgitgqdgsyltefllgkgyevhglirrssnfntqrinhiyalmklhyadltda
    sslrrwidvikpdevynlaaqshvavsfeipdytadvvatgalrlleavrshtidsgrtv
    kyyqagssemfgstpppqsettpfhprspyaaskcaahwytvnyreayglfacngilfnh
    esprrgenfvtrkitralgrikvglqtklflgnlqasrdwgfagdyveamwlmlqqekpd
    dyvvateeghtveefldvsfgylglnwkdyveidqryfrpaevdnlqgdaskakevlgwk
    pqvgfeklvkmmvdedlelakrekvlvdagy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n7hB (B:)
    masenngsrsdsesitapkadstvveprkialitgitgqdgsyltefllgkgyevhglir
    rssnfntqrinhiyidphnvnkalmklhyadltdasslrrwidvikpdevynlaaqshva
    vsfeipdytadvvatgalrlleavrshtidsgrtvkyyqagssemfgstpppqsettpfh
    prspyaaskcaahwytvnyreayglfacngilfnhesprrgenfvtrkitralgrikvgl
    qtklflgnlqasrdwgfagdyveamwlmlqqekpddyvvateeghtveefldvsfgylgl
    nwkdyveidqryfrpaevdnlqgdaskakevlgwkpqvgfeklvkmmvdedlelakrekv
    lvdagymdakqqplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n7hB (B:)
    rkialitgitgqdgsyltefllgkgyevhglirrssnfntqrinhiyikalmklhyadlt
    dasslrrwidvikpdevynlaaqshvavsfeipdytadvvatgalrlleavrshtidsgr
    tvkyyqagssemfgstpppqsettpfhprspyaaskcaahwytvnyreayglfacngilf
    nhesprrgenfvtrkitralgrikvglqtklflgnlqasrdwgfagdyveamwlmlqqek
    pddyvvateeghtveefldvsfgylglnwkdyveidqryfrpaevdnlqgdaskakevlg
    wkpqvgfeklvkmmvdedlelakrekvlvdagym