PDB entry 1n7g

View 1n7g on RCSB PDB site
Description: Crystal Structure of the GDP-mannose 4,6-dehydratase ternary complex with NADPH and GDP-rhamnose.
Class: lyase
Keywords: Rossmann fold, SDR, short-chain dehydrogenase/reductase, LYASE
Deposited on 2002-11-14, released 2003-01-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.201
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-D-mannose-4,6-dehydratase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: mur1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n7ga_
  • Chain 'B':
    Compound: GDP-D-mannose-4,6-dehydratase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: mur1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n7gb_
  • Chain 'C':
    Compound: GDP-D-mannose-4,6-dehydratase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: mur1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n7gc_
  • Chain 'D':
    Compound: GDP-D-mannose-4,6-dehydratase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: mur1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n7gd_
  • Heterogens: NDP, GDR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n7gA (A:)
    masenngsrsdsesitapkadstvveprkialitgitgqdgsyltefllgkgyevhglir
    rssnfntqrinhiyidphnvnkalmklhyadltdasslrrwidvikpdevynlaaqshva
    vsfeipdytadvvatgalrlleavrshtidsgrtvkyyqagssemfgstpppqsettpfh
    prspyaaskcaahwytvnyreayglfacngilfnhesprrgenfvtrkitralgrikvgl
    qtklflgnlqasrdwgfagdyveamwlmlqqekpddyvvateeghtveefldvsfgylgl
    nwkdyveidqryfrpaevdnlqgdaskakevlgwkpqvgfeklvkmmvdedlelakrekv
    lvdagymdakqqplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n7gA (A:)
    rkialitgitgqdgsyltefllgkgyevhglirrssnfntqrinhiykalmklhyadltd
    asslrrwidvikpdevynlaaqshvavsfeipdytadvvatgalrlleavrshtidsgrt
    vkyyqagssemfgstpppqsettpfhprspyaaskcaahwytvnyreayglfacngilfn
    hesprrgenfvtrkitralgrikvglqtklflgnlqasrdwgfagdyveamwlmlqqekp
    ddyvvateeghtveefldvsfgylglnwkdyveidqryfrpaevdnlqgdaskakevlgw
    kpqvgfeklvkmmvdedlelakrekvlvdagym
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n7gB (B:)
    masenngsrsdsesitapkadstvveprkialitgitgqdgsyltefllgkgyevhglir
    rssnfntqrinhiyidphnvnkalmklhyadltdasslrrwidvikpdevynlaaqshva
    vsfeipdytadvvatgalrlleavrshtidsgrtvkyyqagssemfgstpppqsettpfh
    prspyaaskcaahwytvnyreayglfacngilfnhesprrgenfvtrkitralgrikvgl
    qtklflgnlqasrdwgfagdyveamwlmlqqekpddyvvateeghtveefldvsfgylgl
    nwkdyveidqryfrpaevdnlqgdaskakevlgwkpqvgfeklvkmmvdedlelakrekv
    lvdagymdakqqplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n7gB (B:)
    rkialitgitgqdgsyltefllgkgyevhglirrssnfntqrinhiyidkalmklhyadl
    tdasslrrwidvikpdevynlaaqshvavsfeipdytadvvatgalrlleavrshtidsg
    rtvkyyqagssemfgstpppqsettpfhprspyaaskcaahwytvnyreayglfacngil
    fnhesprrgenfvtrkitralgrikvglqtklflgnlqasrdwgfagdyveamwlmlqqe
    kpddyvvateeghtveefldvsfgylglnwkdyveidqryfrpaevdnlqgdaskakevl
    gwkpqvgfeklvkmmvdedlelakrekvlvdagymd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n7gC (C:)
    masenngsrsdsesitapkadstvveprkialitgitgqdgsyltefllgkgyevhglir
    rssnfntqrinhiyidphnvnkalmklhyadltdasslrrwidvikpdevynlaaqshva
    vsfeipdytadvvatgalrlleavrshtidsgrtvkyyqagssemfgstpppqsettpfh
    prspyaaskcaahwytvnyreayglfacngilfnhesprrgenfvtrkitralgrikvgl
    qtklflgnlqasrdwgfagdyveamwlmlqqekpddyvvateeghtveefldvsfgylgl
    nwkdyveidqryfrpaevdnlqgdaskakevlgwkpqvgfeklvkmmvdedlelakrekv
    lvdagymdakqqplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n7gC (C:)
    rkialitgitgqdgsyltefllgkgyevhglirrssnfntqrinhiyikalmklhyadlt
    dasslrrwidvikpdevynlaaqshvavsfeipdytadvvatgalrlleavrshtidsgr
    tvkyyqagssemfgstpppqsettpfhprspyaaskcaahwytvnyreayglfacngilf
    nhesprrgenfvtrkitralgrikvglqtklflgnlqasrdwgfagdyveamwlmlqqek
    pddyvvateeghtveefldvsfgylglnwkdyveidqryfrpaevdnlqgdaskakevlg
    wkpqvgfeklvkmmvdedlelakrekvlvdagym
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n7gD (D:)
    masenngsrsdsesitapkadstvveprkialitgitgqdgsyltefllgkgyevhglir
    rssnfntqrinhiyidphnvnkalmklhyadltdasslrrwidvikpdevynlaaqshva
    vsfeipdytadvvatgalrlleavrshtidsgrtvkyyqagssemfgstpppqsettpfh
    prspyaaskcaahwytvnyreayglfacngilfnhesprrgenfvtrkitralgrikvgl
    qtklflgnlqasrdwgfagdyveamwlmlqqekpddyvvateeghtveefldvsfgylgl
    nwkdyveidqryfrpaevdnlqgdaskakevlgwkpqvgfeklvkmmvdedlelakrekv
    lvdagymdakqqplehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n7gD (D:)
    rkialitgitgqdgsyltefllgkgyevhglirrssnfntqrinhiyilmklhyadltda
    sslrrwidvikpdevynlaaqshvavsfeipdytadvvatgalrlleavrshtidsgrtv
    kyyqagssemfgstpppqsettpfhprspyaaskcaahwytvnyreayglfacngilfnh
    esprrgenfvtrkitralgrikvglqtklfasrdwgfagdyveamwlmlqqekpddyvva
    teeghtveefldvsfgylglnwkdyveiddnlqgdaskakevlgwkpqvgfeklvkmmvd
    edlelakrekvlv