PDB entry 1n7f

View 1n7f on RCSB PDB site
Description: Crystal structure of the sixth PDZ domain of GRIP1 in complex with liprin C-terminal peptide
Class: protein binding
Keywords: PDZ, grip, liprin, PROTEIN BINDING
Deposited on 2002-11-14, released 2003-08-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AMPA receptor interacting protein GRIP
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Grip1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1n7fa_
  • Chain 'B':
    Compound: AMPA receptor interacting protein GRIP
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Grip1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1n7fb_
  • Chain 'C':
    Compound: 8-mer peptide from interacting protein (liprin)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB AAH34046 (0-7)
  • Chain 'D':
    Compound: 8-mer peptide from interacting protein (liprin)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB AAH34046 (0-7)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1n7fA (A:)
ssgaiiytvelkryggplgitisgteepfdpiiissltkgglaertgaihigdrilains
sslkgkplseaihllqmagetvtlkikkqtdaqpass

    Sequence, based on observed residues (ATOM records): (download) 
    >1n7fA (A:)
aiiytvelkryggplgitisgteepfdpiiissltkgglaertgaihigdrilainsssl
kgkplseaihllqmagetvtlkikkq

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1n7fB (B:)
ssgaiiytvelkryggplgitisgteepfdpiiissltkgglaertgaihigdrilains
sslkgkplseaihllqmagetvtlkikkqtdaqpass

    Sequence, based on observed residues (ATOM records): (download) 
    >1n7fB (B:)
aiiytvelkryggplgitisgteepfdpiiissltkgglaertgaihigdrilainsssl
kgkplseaihllqmagetvtlkikkq

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.