PDB entry 1n7e

View 1n7e on RCSB PDB site
Description: Crystal structure of the sixth PDZ domain of GRIP1
Class: protein binding
Keywords: PDZ, grip, PROTEIN BINDING
Deposited on 2002-11-14, released 2003-08-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.254
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AMPA receptor interacting protein GRIP
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Grip1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1n7ea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n7eA (A:)
    ssgaiiytvelkryggplgitisgteepfdpiiissltkgglaertgaihigdrilains
    sslkgkplseaihllqmagetvtlkikkqtdaqpass
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n7eA (A:)
    gaiiytvelkryggplgitisgteepfdpiiissltkgglaertgaihigdrilainsss
    lkgkplseaihllqmagetvtlkikkqtdaqpass