PDB entry 1n7d

View 1n7d on RCSB PDB site
Description: Extracellular domain of the LDL receptor
Class: lipid transport
Keywords: LDL-Receptor, familial hypercholesterolemia, LDL, cholesterol metabolism, LIPID TRANSPORT
Deposited on 2002-11-13, released 2003-01-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3.7 Å
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n7dA (A:)
    avgdrcernefqcqdgkcisykwvcdgsaecqdgsdesqetclsvtcksgdfscggrvnr
    cipqfwrcdgqvdcdngsdeqgcppktcsqdefrchdgkcisrqfvcdsdrdcldgsdea
    scpvltcgpasfqcnsstcipqlwacdndpdcedgsdewpqrcrglyvfqgdsspcsafe
    fhclsgecihsswrcdggpdckdksdeencavatcrpdefqcsdgncihgsrqcdreydc
    kdmsdevgcvnvtlcegpnkfkchsgecitldkvcnmardcrdwsdepikecgtnecldn
    nggcshvcndlkigyeclcpdgfqlvaqrrcedidecqdpdtcsqlcvnleggykcqcee
    gfqldphtkackavgsiaylfftnrhevrkmtldrseytslipnlrnvvaldtevasnri
    ywsdlsqrmicstqldrahgvssydtvisrdiqapdglavdwihsniywtdsvlgtvsva
    dtkgvkrktlfreqgskpraivvdpvhgfmywtdwgtpakikkgglngvdiyslvteniq
    wpngitldllsgrlywvdsklhsissidvnggnrktiledekrlahpfslavfedkvfwt
    diineaifsanrltgsdvnllaenllspedmvlfhqltqprgvnwcerttlsnggcqylc
    lpapqinphspkftcacpdgmllardmrsclteaeaava
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n7dA (A:)
    svtcksgdfscggnrcipqfwrcdgqvdcngsdeqgcppktcsqdefrchdgrqfvcdsd
    rdcldgsdeascpvltcgpasfqcnsstcipqlwacdndpdcedgsdewpqrcrglyvfq
    gdsspcsafefhclsgecihsswrcdggpdckdksdeencavatcrpdefqcsdgncihg
    srqcdreydckdmsdevgcvnvtlcegpnkfkchsgecitldkvcnmardcrdwsdepik
    ecgtnecldnnggcshvcndlkigyeclcpdgfqlvaqrrcedidecqdpdtcsqlcvnl
    eggykcqceegfqldphtkackavgsiaylfftnrherkmtldrseytslipnlrnvval
    dtevasnriywsdlsqrmicstqldrahgssydtvisrdipdglavdwihsniywtdsvl
    gtvsvadtkgvkrktlfreqgskpraivvdpvhgfmywtdwgtpakikkgglngvdiysl
    vteniqwpngitldllsgrlywvdsklhsissidvnggnrktiledekrlahpfslavfe
    dkvfwtdiineaifsanrltgsdvnllaenllspedmvlfhqltqprgvnwcerttlsng
    gcqylclpapqinphspkftcacpdgmllardmrsclte