PDB entry 1n77

View 1n77 on RCSB PDB site
Description: Crystal structure of Thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(Glu) and ATP.
Class: ligase/RNA
Keywords: ERS/tRNA/ATP, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, ligase/RNA COMPLEX
Deposited on 2002-11-13, released 2003-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.213
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27000 (0-467)
      • see remark 999 (73-74)
      • see remark 999 (76)
    Domains in SCOPe 2.07: d1n77a1, d1n77a2
  • Chain 'B':
    Compound: Glutamyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27000 (0-467)
      • see remark 999 (73-74)
      • see remark 999 (76)
    Domains in SCOPe 2.07: d1n77b1, d1n77b2
  • Chain 'C':
    Compound: tRNA(glu)
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: tRNA(glu)
    Species: synthetic, synthetic
  • Heterogens: MG, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n77A (A:)
    mvvtriapsptgdphvgtayialfnyawarrnggrfivriedtdraryvpgaeerilaal
    kwlglsydegpdvggphgpyrqserlplyqkyaeellkrgwayrafetpeeleqirkekg
    gydgrarnippeeaeerarrgephvirlkvprpgttevkdelrgvvvydnqeipdvvllk
    sdgyptyhlanvvddhlmgvtdviraeewlvstpihvllyrafgweaprfyhmpllrnpd
    ktkiskrkshtsldwykaegflpealrnylclmgfsmpdgreiftleefiqaftwervsl
    ggpvfdleklrwmngkyirevlsleevaervkpflreaglsweseaylrravelmrprfd
    tlkefpekarylftedypvsekaqrkleeglpllkelyprlraqeewteaaleallrgfa
    aekgvklgqvaqplraaltgsletpglfeilallgkeralrrlerala
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n77B (B:)
    mvvtriapsptgdphvgtayialfnyawarrnggrfivriedtdraryvpgaeerilaal
    kwlglsydegpdvggphgpyrqserlplyqkyaeellkrgwayrafetpeeleqirkekg
    gydgrarnippeeaeerarrgephvirlkvprpgttevkdelrgvvvydnqeipdvvllk
    sdgyptyhlanvvddhlmgvtdviraeewlvstpihvllyrafgweaprfyhmpllrnpd
    ktkiskrkshtsldwykaegflpealrnylclmgfsmpdgreiftleefiqaftwervsl
    ggpvfdleklrwmngkyirevlsleevaervkpflreaglsweseaylrravelmrprfd
    tlkefpekarylftedypvsekaqrkleeglpllkelyprlraqeewteaaleallrgfa
    aekgvklgqvaqplraaltgsletpglfeilallgkeralrrlerala
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.