PDB entry 1n71

View 1n71 on RCSB PDB site
Description: Crystal structure of aminoglycoside 6'-acetyltransferase type Ii in complex with coenzyme A
Class: transferase
Keywords: aminoglycoside 6'-n-acetyltransferase, antibiotic resistance, coenzyme a
Deposited on 2002-11-12, released 2003-03-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.208
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aac(6')-Ii
    Species: Enterococcus faecium [TaxId:1352]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47764 (0-179)
      • see remark 999 (126)
    Domains in SCOPe 2.08: d1n71a_
  • Chain 'B':
    Compound: aac(6')-Ii
    Species: Enterococcus faecium [TaxId:1352]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47764 (0-End)
      • see remark 999 (126)
    Domains in SCOPe 2.08: d1n71b_
  • Chain 'C':
    Compound: aac(6')-Ii
    Species: Enterococcus faecium [TaxId:1352]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47764 (0-End)
      • see remark 999 (126)
    Domains in SCOPe 2.08: d1n71c_
  • Chain 'D':
    Compound: aac(6')-Ii
    Species: Enterococcus faecium [TaxId:1352]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q47764 (0-179)
      • see remark 999 (126)
    Domains in SCOPe 2.08: d1n71d_
  • Heterogens: SO4, COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n71A (A:)
    miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
    gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
    sqtdlyehtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n71B (B:)
    miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
    gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
    sqtdlyehtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n71B (B:)
    miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
    gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
    sqtdlyehtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n71C (C:)
    miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
    gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
    sqtdlyehtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n71C (C:)
    miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
    gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
    sqtdlyehtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n71D (D:)
    miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
    gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
    sqtdlyehtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprpd