PDB entry 1n6v

View 1n6v on RCSB PDB site
Description: average structure of the interferon-binding ectodomain of the human type i interferon receptor
Deposited on 2002-11-12, released 2003-07-15
The last revision prior to the SCOP 1.67 freeze date was dated 2003-07-15, with a file datestamp of 2003-07-15.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1n6vA (A:)
sydspdytdesctfkislrnfrsilswelknhsivpthytllytimskpedlkvvkncan
ttrsfcdltdewrstheayvtvlegfsgnttlfscshnfwlaidmsfeppefeivgftnh
invmvkfpsiveeelqfdlslvieeqsegivkkhkpeikgnmsgnftyiidklipntnyc
vsvylehsdeqaviksplkctllppgqesefs