PDB entry 1n6m

View 1n6m on RCSB PDB site
Description: Rotation of the stalk/neck and one head in a new crystal structure of the kinesin motor protein, Ncd
Class: cell cycle
Keywords: NCD, Microtubule, motor, kinesin, CELL CYCLE
Deposited on 2002-11-11, released 2003-10-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.26
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Claret segregational protein
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20480 (1-End)
      • initiating met (0)
      • engineered (308)
    Domains in SCOPe 2.03: d1n6ma_
  • Chain 'B':
    Compound: Claret segregational protein
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20480 (1-End)
      • initiating met (0)
      • engineered (308)
    Domains in SCOPe 2.03: d1n6mb_
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n6mA (A:)
    mhaalstevvhlrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirv
    fcrirppleseenrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdi
    femvspliqsaldgynicifaygqtgsgktytmdgvpesvgviprtvdllfdsirgyrnl
    gweyeikatfleiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhl
    mhtakmnratastagnerssrshavtkleligrhaekqeisvgsinlvdlagsespktst
    rmtetknikrslseltnvilallqkqdhipyrnsklthllmpslggnsktlmfinvspfq
    dcfqesvkslrfaasvnsckmtkakrnrylnnsvansstqsnnsgsfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6mA (A:)
    mhaalstevvhlrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirv
    fcrirppleseenrmcctwtyhdestvelqsidaqmgqqifsfdqvfhplssqsdifemv
    spliqsaldgynicifaygqtgsgktytmdgvpesvgviprtvdllfdsirgyrnlgwey
    eikatfleiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhlmhta
    kmnrassrshavtkleligrhaekqeisvgsinlvdlagsespktetknikrslseltnv
    ilallqkqdhipyrnsklthllmpslggnsktlmfinvspfqdcfqesvkslrfaasvns
    ck
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n6mB (B:)
    mhaalstevvhlrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirv
    fcrirppleseenrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdi
    femvspliqsaldgynicifaygqtgsgktytmdgvpesvgviprtvdllfdsirgyrnl
    gweyeikatfleiynevlydllsneqkdmeirmaknnkndiyvsniteetvldpnhlrhl
    mhtakmnratastagnerssrshavtkleligrhaekqeisvgsinlvdlagsespktst
    rmtetknikrslseltnvilallqkqdhipyrnsklthllmpslggnsktlmfinvspfq
    dcfqesvkslrfaasvnsckmtkakrnrylnnsvansstqsnnsgsfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6mB (B:)
    mhaalstevvhlrqrteellrcneqqaaeletckeqlfqsnmerkelhntvmdlrgnirv
    fcrirppleseenrmcctwtyhdestvelqsidaqakskmgqqifsfdqvfhplssqsdi
    femvspliqsaldgynicifaygqtgsgktytmdgvpesvgviprtvdllfdsirgyrnl
    gweyeikatfleiynevlydllsneteetvldpnhlrhlmhtakmnratastassrshav
    tkleligrhaeisvgsinlvdlagsespnikrslseltnvilallqkqyrnsklthllmp
    slggnsktlmfinvspfqdcfqesvkslrfaasvn