PDB entry 1n6f

View 1n6f on RCSB PDB site
Description: tricorn protease in complex with Z-Phe-diketo-Arg-Glu-Phe
Class: hydrolase
Keywords: tricorn protease, hydrolase, propeller
Deposited on 2002-11-10, released 2002-12-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.247
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n6fA (A:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6fA (A:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n6fB (B:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6fB (B:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n6fC (C:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6fC (C:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n6fD (D:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6fD (D:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1n6fE (E:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6fE (E:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1n6fF (F:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6fF (F:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn