PDB entry 1n6e

View 1n6e on RCSB PDB site
Description: tricorn protease in complex with a tridecapeptide chloromethyl ketone derivative
Deposited on 2002-11-10, released 2002-12-30
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-30, with a file datestamp of 2002-12-30.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.254
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n6eA (A:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n6eC (C:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n6eE (E:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n6eG (G:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n6eI (I:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n6eK (K:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn