PDB entry 1n6e

View 1n6e on RCSB PDB site
Description: tricorn protease in complex with a tridecapeptide chloromethyl ketone derivative
Class: hydrolase
Keywords: tricorn protease, hydrolase, propeller
Deposited on 2002-11-10, released 2002-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.254
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tricorn protease
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n6ea1, d1n6ea2, d1n6ea3, d1n6ea4
  • Chain 'B':
    Compound: dqtqkaaaeltff
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1N6E (Start-12)
  • Chain 'C':
    Compound: tricorn protease
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n6ec1, d1n6ec2, d1n6ec3, d1n6ec4
  • Chain 'D':
    Compound: dqtqkaaaeltff
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1N6E (Start-12)
  • Chain 'E':
    Compound: tricorn protease
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n6ee1, d1n6ee2, d1n6ee3, d1n6ee4
  • Chain 'F':
    Compound: dqtqkaaaeltff
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1N6E (Start-12)
  • Chain 'G':
    Compound: tricorn protease
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n6eg1, d1n6eg2, d1n6eg3, d1n6eg4
  • Chain 'H':
    Compound: dqtqkaaaeltff
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1N6E (Start-12)
  • Chain 'I':
    Compound: tricorn protease
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n6ei1, d1n6ei2, d1n6ei3, d1n6ei4
  • Chain 'J':
    Compound: dqtqkaaaeltff
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1N6E (Start-12)
  • Chain 'K':
    Compound: tricorn protease
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n6ek1, d1n6ek2, d1n6ek3, d1n6ek4
  • Chain 'L':
    Compound: dqtqkaaaeltff
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1N6E (Start-12)
  • Heterogens: CHM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n6eA (A:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6eA (A:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n6eC (C:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6eC (C:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1n6eE (E:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6eE (E:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1n6eG (G:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6eG (G:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1n6eI (I:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6eI (I:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1n6eK (K:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6eK (K:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'L':
    No sequence available.