PDB entry 1n6d

View 1n6d on RCSB PDB site
Description:
Deposited on 2002-11-10, released 2002-12-30
The last revision prior to the SCOP 1.65 freeze date was dated 2002-12-30, with a file datestamp of 2002-12-30.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.285
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n6dA (A:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6dA (A:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n6dB (B:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6dB (B:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n6dC (C:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6dC (C:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n6dD (D:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6dD (D:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1n6dE (E:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6dE (E:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1n6dF (F:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6dF (F:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn