PDB entry 1n6d

View 1n6d on RCSB PDB site
Description: Tricorn protease in complex with tetrapeptide chloromethyl ketone derivative
Class: hydrolase
Keywords: tricorn protease, hydrolase, propeller
Deposited on 2002-11-10, released 2002-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.285
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tricorn protease
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n6da1, d1n6da2, d1n6da3, d1n6da4
  • Chain 'B':
    Compound: tricorn protease
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n6db1, d1n6db2, d1n6db3, d1n6db4
  • Chain 'C':
    Compound: tricorn protease
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n6dc1, d1n6dc2, d1n6dc3, d1n6dc4
  • Chain 'D':
    Compound: tricorn protease
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n6dd1, d1n6dd2, d1n6dd3, d1n6dd4
  • Chain 'E':
    Compound: tricorn protease
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n6de1, d1n6de2, d1n6de3, d1n6de4
  • Chain 'F':
    Compound: tricorn protease
    Species: Thermoplasma acidophilum [TaxId:2303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n6df1, d1n6df2, d1n6df3, d1n6df4
  • Chain 'G':
    Compound: rvrk
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1N6D (0-3)
  • Chain 'H':
    Compound: rvrk
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1N6D (0-3)
  • Chain 'I':
    Compound: rvrk
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1N6D (0-3)
  • Chain 'J':
    Compound: rvrk
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1N6D (0-3)
  • Chain 'K':
    Compound: rvrk
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1N6D (0-3)
  • Chain 'L':
    Compound: rvrk
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1N6D (0-3)
  • Heterogens: D10, CHM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n6dA (A:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6dA (A:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n6dB (B:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6dB (B:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n6dC (C:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6dC (C:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n6dD (D:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6dD (D:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1n6dE (E:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6dE (E:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1n6dF (F:)
    mpslmsfgscqwidqgrfsrslyrnfktfklhemhglcmpnlllnpdihgdriifvccdd
    lwehdlksgstrkivsnlgvinnarffpdgrkiairvmrgsslntadlyfyngengeikr
    ityfsgkstgrrmftdvagfdpdgnliistdamqpfssmtclyrvendginfvplnlgpa
    thilfadgrrvigrntfelphwkgyrggtrgkiwievnsgafkkivdmsthvsspvivgh
    riyfitdidgfgqiystdldgkdlrkhtsftdyyprhlntdgrrilfskggsiyifnpdt
    ekiekieigdlespedriisipskfaedfspldgdliafvsrgqafiqdvsgtyvlkvpe
    plriryvrrggdtkvafihgtregdflgiydyrtgkaekfeenlgnvfamgvdrngkfav
    vandrfeimtvdletgkptviersreamitdftisdnsrfiaygfplkhgetdgyvmqai
    hvydmegrkifaattenshdyapafdadsknlyylsyrsldpspdrvvlnfsfevvskpf
    viplipgspnptklvprsmtseageydlndmykrsspinvdpgdyrmiiplessiliysv
    pvhgefaayyqgapekgvllkydvktrkvtevknnltdlrlsadrktvmvrkddgkiytf
    plekpedertvetdkrplvssiheeflqmydeawklardnywneavakeiseriyekyrn
    lvplcktrydlsnvivemqgeyrtshsyemggtftdkdpfrsgriacdfkldgdhyvvak
    ayagdysnegekspifeygidptgyliedidgetvgagsniyrvlsekagtsarirlsgk
    ggdkrdlmidildddrfiryrswveanrryvherskgtigyihipdmgmmglnefyrlfi
    nessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptnsvrgkiiaitn
    eyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqpefafwfrdagf
    gvenygvdpdveieyaphdylsgkdpqidyaidalieelrnwneelpqrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6dF (F:)
    mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
    rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
    mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
    sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
    ntdgrrilfskggsiyifnpdtekiekieigdlespedriisipskfaedfspldgdlia
    fvsrgqafiqdvsgtyvlkvpeplriryvrrggdtkvafihgtregdflgiydyrtgkae
    kfeenlgnvfamgvdrngkfavvandrfeimtvdletgkptviersreamitdftisdns
    rfiaygfplkhgetdgyvmqaihvydmegrkifaattenshdyapafdadsknlyylsyr
    sldpspdrvvlnfsfevvskpfviplipgspnptklvprsmtseageydlndmykrsspi
    nvdpgdyrmiiplessiliysvpvhgefaayyqgapekgvllkydvktrkvtevknnltd
    lrlsadrktvmvrkddgkiytfplekpedertvetdkrplvssiheeflqmydeawklar
    dnywneavakeiseriyekyrnlvplcktrydlsnvivemqgeyrtshsyemggtftdkd
    pfrsgriacdfkldgdhyvvakayagdysnegekspifeygidptgyliedidgetvgag
    sniyrvlsekagtsarirlsgkggdkrdlmidildddrfiryrswveanrryvherskgt
    igyihipdmgmmglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnp
    rrgtlspyptnsvrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkr
    rlidgtvltqpefafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidaliee
    lrn
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.