PDB entry 1n6a

View 1n6a on RCSB PDB site
Description: Structure of SET7/9
Class: transferase
Keywords: protein-ligand complex, transferase
Deposited on 2002-11-09, released 2003-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.194
AEROSPACI score: -1.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SET domain-containing protein 7
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WTS6
      • modified residue (31)
      • modified residue (56)
      • modified residue (65)
      • modified residue (77)
      • modified residue (134)
      • modified residue (199)
    Domains in SCOPe 2.07: d1n6aa1, d1n6aa2
  • Heterogens: SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n6aA (A:)
    gqykdnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemieg
    klatlmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissag
    eglfskvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvsky
    caslghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksgp
    eapewyqvelkafqatqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6aA (A:)
    hgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmst
    eegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissageglfskva
    vgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycaslghka
    nhsftpnciydmfvhprfgpikcirtlraveadeeltvaygypewyqvelkafq