PDB entry 1n6a

View 1n6a on RCSB PDB site
Description: Structure of SET7/9
Deposited on 2002-11-09, released 2003-02-04
The last revision prior to the SCOP 1.69 freeze date was dated 2003-02-04, with a file datestamp of 2003-02-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.194
AEROSPACI score: -1.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n6aA (A:)
    gqykdnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemieg
    klatlmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissag
    eglfskvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvsky
    caslghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksgp
    eapewyqvelkafqatqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n6aA (A:)
    hgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmst
    eegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissageglfskva
    vgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycaslghka
    nhsftpnciydmfvhprfgpikcirtlraveadeeltvaygypewyqvelkafq