PDB entry 1n67

View 1n67 on RCSB PDB site
Description: Clumping Factor A from Staphylococcus aureus
Class: cell adhesion
Keywords: DEv-IgG, IgG, Immunoglobulin, IgSF, Clumping Factor, Staphylococcus aureus, fibrinongen-binding, CELL ADHESION
Deposited on 2002-11-08, released 2003-03-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Clumping Factor
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53653 (Start-357)
      • cloning artifact (358)
    Domains in SCOPe 2.07: d1n67a1, d1n67a2, d1n67a3
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n67A (A:)
    mrgshhhhhhgslvprgsmvaadapaagtditnqltnvtvgidsgttvyphqagyvklny
    gfsvpnsavkgdtfkitvpkelnlngvtstakvppimagdqvlangvidsdgnviytftd
    yvntkddvkatltmpayidpenvkktgnvtlatgigsttanktvlvdyekygkfynlsik
    gtidqidktnntyrqtiyvnpsgdnviapvltgnlkpntdsnalidqqntsikvykvdna
    adlsesyfvnpenfedvtnsvnitfpnpnqykvefntpddqittpyivvvnghidpnskg
    dlalrstlygynsniiwrsmswdnevafnngsgsgdgidkpvvpeqpdepgeiepipek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n67A (A:)
    gtditnqltnvtvgidsgttvyphqagyvklnygfsvpnsavkgdtfkitvpkelnlngv
    tstakvppimagdqvlangvidsdgnviytftdyvntkddvkatltmpayidpenvkktg
    nvtlatgigsttanktvlvdyekygkfynlsikgtidqidktnntyrqtiyvnpsgdnvi
    apvltgnlkpntdsnalidqqntsikvykvdnaadlsesyfvnpenfedvtnsvnitfpn
    pnqykvefntpddqittpyivvvnghidpnskgdlalrstlygynsniiwrsmswdneva
    fnngsgsgdgidkpvvpeqpdepgeiepipek