PDB entry 1n64

View 1n64 on RCSB PDB site
Description: Crystal structure analysis of the immunodominant antigenic site on Hepatitis C virus protein bound to mAb 19D9D6
Deposited on 2002-11-08, released 2003-02-25
The last revision prior to the SCOP 1.69 freeze date was dated 2003-02-25, with a file datestamp of 2003-02-25.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.19
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n64H (H:)
    qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
    addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n64L (L:)
    divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkvliywastr
    esgvpdrftgrgsgtdftltissvqaedqavyyckqayippltfgagtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrnec