PDB entry 1n62

View 1n62 on RCSB PDB site
Description:
Deposited on 2002-11-08, released 2002-12-18
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-18, with a file datestamp of 2002-12-18.
Experiment type: XRAY
Resolution: 1.09 Å
R-factor: 0.144
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n62a1, d1n62a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n62b1, d1n62b2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n62c1, d1n62c2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n62d1, d1n62d2
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n62e1, d1n62e2
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1n62f1, d1n62f2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n62A (A:)
    kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
    tmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqenps
    pteaeirfgiggnlcrctgyqnivkaiqyaaakingvpfee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n62B (B:)
    tveptsaeraeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshaharik
    sidtskakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakd
    ryvaadaielvevdyeplpvlvdpfkamepdapllredikdkmtgahgarkhhnhifrwe
    igdkegtdatfakaevvskdmftyhrvhpspletcqcvasmdkikgeltlwgtfqaphvi
    rtvvslisglpehkihviapdigggfgnkvgaysgyvcavvasivlgvpvkwvedrmenl
    sttsfardyhmttelaatkdgkilamrchvladhgafdacadpskwpagfmnictgsydm
    pvahlavdgvytnkasggvayrcsfrvteavyaieraietlaqrlemdsadlriknfiqp
    eqfpymaplgweydsgnyplamkkamdtvgyhqlraeqkakqeafkrgetreimgigisf
    fteivgagpskncdilgvsmfdsaeirihptgsviarmgtksqgqghettyaqiiatelg
    ipaddimieegntdtapyglgtygsrstptagaatavaarkikakaqmiaahmlevhegd
    lewdvdrfrvkglpekfktmkelawasynspppnlepgleavnyydppnmtypfgayfci
    mdidvdtgvaktrrfyalddcgtrinpmiiegqvhgglteafavamgqeirydeqgnvlg
    asfmdfflptavetpkwetdytvtpsphhpigakgvgesphvggvpcfsnavndayafln
    aghiqmphdawrlwkvgeqlglhv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n62C (C:)
    mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
    vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
    pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvpptghg
    yayeklkrkigdyataaaavvltmsggkcvtasigltnvantplwaeeagkvlvgtaldk
    paldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakara
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n62D (D:)
    akahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvks
    ctmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqenp
    spteaeirfgiggnlcrctgyqnivkaiqyaaakingvp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n62E (E:)
    raeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshahariksidtskak
    alpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakdryvaadai
    elvevdyeplpvlvdpfkamepdapllredikdkmtgahgarkhhnhifrweigdkegtd
    atfakaevvskdmftyhrvhpspletcqcvasmdkikgeltlwgtfqaphvirtvvslis
    glpehkihviapdigggfgnkvgaysgyvcavvasivlgvpvkwvedrmenlsttsfard
    yhmttelaatkdgkilamrchvladhgafdacadpskwpagfmnictgsydmpvahlavd
    gvytnkasggvayrcsfrvteavyaieraietlaqrlemdsadlriknfiqpeqfpymap
    lgweydsgnyplamkkamdtvgyhqlraeqkakqeafkrgetreimgigisffteivgag
    pskncdilgvsmfdsaeirihptgsviarmgtksqgqghettyaqiiatelgipaddimi
    eegntdtapyglgtygsrstptagaatavaarkikakaqmiaahmlevhegdlewdvdrf
    rvkglpekfktmkelawasynspppnlepgleavnyydppnmtypfgayfcimdidvdtg
    vaktrrfyalddcgtrinpmiiegqvhgglteafavamgqeirydeqgnvlgasfmdffl
    ptavetpkwetdytvtpsphhpigakgvgesphvggvpcfsnavndayaflnaghiqmph
    dawrlwkvgeqlglhv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n62F (F:)
    mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
    vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
    pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvpptghg
    yayeklkrkigdyataaaavvltmsggkcvtasigltnvantplwaeeagkvlvgtaldk
    paldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakara