PDB entry 1n61

View 1n61 on RCSB PDB site
Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Dithionite reduced state
Deposited on 2002-11-08, released 2002-12-18
The last revision prior to the SCOP 1.71 freeze date was dated 2002-12-18, with a file datestamp of 2002-12-18.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.145
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n61A (A:)
    makahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvk
    sctmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqen
    pspteaeirfgiggnlcrctgyqnivkaiqyaaakingvpfeeaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n61A (A:)
    kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
    tmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqenps
    pteaeirfgiggnlcrctgyqnivkaiqyaaakingvpfee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n61B (B:)
    mniqttveptsaeraeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrssha
    hariksidtskakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevaf
    vvakdryvaadaielvevdyeplpvlvdpfkamepdapllredikdkmtgahgarkhhnh
    ifrweigdkegtdatfakaevvskdmftyhrvhpspletcqcvasmdkikgeltlwgtfq
    aphvirtvvslisglpehkihviapdigggfgnkvgaysgyvcavvasivlgvpvkwved
    rmenlsttsfardyhmttelaatkdgkilamrchvladhgafdacadpskwpagfmnict
    gsydmpvahlavdgvytnkasggvayrcsfrvteavyaieraietlaqrlemdsadlrik
    nfiqpeqfpymaplgweydsgnyplamkkamdtvgyhqlraeqkakqeafkrgetreimg
    igisffteivgagpskncdilgvsmfdsaeirihptgsviarmgtksqgqghettyaqii
    atelgipaddimieegntdtapyglgtygsrstptagaatavaarkikakaqmiaahmle
    vhegdlewdvdrfrvkglpekfktmkelawasynspppnlepgleavnyydppnmtypfg
    ayfcimdidvdtgvaktrrfyalddcgtrinpmiiegqvhgglteafavamgqeirydeq
    gnvlgasfmdfflptavetpkwetdytvtpsphhpigakgvgesphvggvpcfsnavnda
    yaflnaghiqmphdawrlwkvgeqlglhv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n61B (B:)
    tveptsaeraeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshaharik
    sidtskakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakd
    ryvaadaielvevdyeplpvlvdpfkamepdapllredikdkmtgahgarkhhnhifrwe
    igdkegtdatfakaevvskdmftyhrvhpspletcqcvasmdkikgeltlwgtfqaphvi
    rtvvslisglpehkihviapdigggfgnkvgaysgyvcavvasivlgvpvkwvedrmenl
    sttsfardyhmttelaatkdgkilamrchvladhgafdacadpskwpagfmnictgsydm
    pvahlavdgvytnkasggvayrcsfrvteavyaieraietlaqrlemdsadlriknfiqp
    eqfpymaplgweydsgnyplamkkamdtvgyhqlraeqkakqeafkrgetreimgigisf
    fteivgagpskncdilgvsmfdsaeirihptgsviarmgtksqgqghettyaqiiatelg
    ipaddimieegntdtapyglgtygsrstptagaatavaarkikakaqmiaahmlevhegd
    lewdvdrfrvkglpekfktmkelawasynspppnlepgleavnyydppnmtypfgayfci
    mdidvdtgvaktrrfyalddcgtrinpmiiegqvhgglteafavamgqeirydeqgnvlg
    asfmdfflptavetpkwetdytvtpsphhpigakgvgesphvggvpcfsnavndayafln
    aghiqmphdawrlwkvgeqlglhv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n61C (C:)
    mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
    vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
    pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvpptghg
    yayeklkrkigdyataaaavvltmsggkcvtasigltnvantplwaeeagkvlvgtaldk
    paldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakarakn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n61C (C:)
    mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
    vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
    pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvpptghg
    yayeklkrkigdyataaaavvltmsggkcvtasigltnvantplwaeeagkvlvgtaldk
    paldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakarak
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n61D (D:)
    makahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvk
    sctmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqen
    pspteaeirfgiggnlcrctgyqnivkaiqyaaakingvpfeeaae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n61D (D:)
    kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
    tmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqenps
    pteaeirfgiggnlcrctgyqnivkaiqyaaakingvp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1n61E (E:)
    mniqttveptsaeraeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrssha
    hariksidtskakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevaf
    vvakdryvaadaielvevdyeplpvlvdpfkamepdapllredikdkmtgahgarkhhnh
    ifrweigdkegtdatfakaevvskdmftyhrvhpspletcqcvasmdkikgeltlwgtfq
    aphvirtvvslisglpehkihviapdigggfgnkvgaysgyvcavvasivlgvpvkwved
    rmenlsttsfardyhmttelaatkdgkilamrchvladhgafdacadpskwpagfmnict
    gsydmpvahlavdgvytnkasggvayrcsfrvteavyaieraietlaqrlemdsadlrik
    nfiqpeqfpymaplgweydsgnyplamkkamdtvgyhqlraeqkakqeafkrgetreimg
    igisffteivgagpskncdilgvsmfdsaeirihptgsviarmgtksqgqghettyaqii
    atelgipaddimieegntdtapyglgtygsrstptagaatavaarkikakaqmiaahmle
    vhegdlewdvdrfrvkglpekfktmkelawasynspppnlepgleavnyydppnmtypfg
    ayfcimdidvdtgvaktrrfyalddcgtrinpmiiegqvhgglteafavamgqeirydeq
    gnvlgasfmdfflptavetpkwetdytvtpsphhpigakgvgesphvggvpcfsnavnda
    yaflnaghiqmphdawrlwkvgeqlglhv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n61E (E:)
    aeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshahariksidtskaka
    lpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakdryvaadaie
    lvevdyeplpvlvdpfkamepdapllredikdkmtgahgarkhhnhifrweigdkegtda
    tfakaevvskdmftyhrvhpspletcqcvasmdkikgeltlwgtfqaphvirtvvslisg
    lpehkihviapdigggfgnkvgaysgyvcavvasivlgvpvkwvedrmenlsttsfardy
    hmttelaatkdgkilamrchvladhgafdacadpskwpagfmnictgsydmpvahlavdg
    vytnkasggvayrcsfrvteavyaieraietlaqrlemdsadlriknfiqpeqfpymapl
    gweydsgnyplamkkamdtvgyhqlraeqkakqeafkrgetreimgigisffteivgagp
    skncdilgvsmfdsaeirihptgsviarmgtksqgqghettyaqiiatelgipaddimie
    egntdtapyglgtygsrstptagaatavaarkikakaqmiaahmlevhegdlewdvdrfr
    vkglpekfktmkelawasynspppnlepgleavnyydppnmtypfgayfcimdidvdtgv
    aktrrfyalddcgtrinpmiiegqvhgglteafavamgqeirydeqgnvlgasfmdfflp
    tavetpkwetdytvtpsphhpigakgvgesphvggvpcfsnavndayaflnaghiqmphd
    awrlwkvgeqlglhv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1n61F (F:)
    mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
    vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
    pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvpptghg
    yayeklkrkigdyataaaavvltmsggkcvtasigltnvantplwaeeagkvlvgtaldk
    paldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakarakn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n61F (F:)
    mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
    vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
    pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvpptghg
    yayeklkrkigdyataaaavvltmsggkcvtasigltnvantplwaeeagkvlvgtaldk
    paldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakara