PDB entry 1n60

View 1n60 on RCSB PDB site
Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Cyanide-inactivated Form
Deposited on 2002-11-08, released 2002-12-18
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-18, with a file datestamp of 2002-12-18.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: 0.143
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n60A (A:)
    kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
    tmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqenps
    pteaeirfgiggnlcrctgyqnivkaiqyaaakingvpfee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n60B (B:)
    veptsaeraeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshahariks
    idtskakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakdr
    yvaadaielvevdyeplpvlvdpfkamepdapllredikdkmtgahgarkhhnhifrwei
    gdkegtdatfakaevvskdmftyhrvhpspletcqcvasmdkikgeltlwgtfqaphvir
    tvvslisglpehkihviapdigggfgnkvgaysgyvcavvasivlgvpvkwvedrmenls
    ttsfardyhmttelaatkdgkilamrchvladhgafdacadpskwpagfmnictgsydmp
    vahlavdgvytnkasggvayrcsfrvteavyaieraietlaqrlemdsadlriknfiqpe
    qfpymaplgweydsgnyplamkkamdtvgyhqlraeqkakqeafkrgetreimgigisff
    teivgagpskncdilgvsmfdsaeirihptgsviarmgtksqgqghettyaqiiatelgi
    paddimieegntdtapyglgtygsrstptagaatavaarkikakaqmiaahmlevhegdl
    ewdvdrfrvkglpekfktmkelawasynspppnlepgleavnyydppnmtypfgayfcim
    didvdtgvaktrrfyalddcgtrinpmiiegqvhgglteafavamgqeirydeqgnvlga
    sfmdfflptavetpkwetdytvtpsphhpigakgvgesphvggvpcfsnavndayaflna
    ghiqmphdawrlwkvgeqlglhv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n60C (C:)
    mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
    vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
    pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvpptghg
    yayeklkrkigdyataaaavvltmsggkcvtasigltnvantplwaeeagkvlvgtaldk
    paldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakara
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n60D (D:)
    kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
    tmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqenps
    pteaeirfgiggnlcrctgyqnivkaiqyaaakingvp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n60E (E:)
    raeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshahariksidtskak
    alpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakdryvaadai
    elvevdyeplpvlvdpfkamepdapllredikdkmtgahgarkhhnhifrweigdkegtd
    atfakaevvskdmftyhrvhpspletcqcvasmdkikgeltlwgtfqaphvirtvvslis
    glpehkihviapdigggfgnkvgaysgyvcavvasivlgvpvkwvedrmenlsttsfard
    yhmttelaatkdgkilamrchvladhgafdacadpskwpagfmnictgsydmpvahlavd
    gvytnkasggvayrcsfrvteavyaieraietlaqrlemdsadlriknfiqpeqfpymap
    lgweydsgnyplamkkamdtvgyhqlraeqkakqeafkrgetreimgigisffteivgag
    pskncdilgvsmfdsaeirihptgsviarmgtksqgqghettyaqiiatelgipaddimi
    eegntdtapyglgtygsrstptagaatavaarkikakaqmiaahmlevhegdlewdvdrf
    rvkglpekfktmkelawasynspppnlepgleavnyydppnmtypfgayfcimdidvdtg
    vaktrrfyalddcgtrinpmiiegqvhgglteafavamgqeirydeqgnvlgasfmdffl
    ptavetpkwetdytvtpsphhpigakgvgesphvggvpcfsnavndayaflnaghiqmph
    dawrlwkvgeqlglhv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n60F (F:)
    mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
    vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
    pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvpptghg
    yayeklkrkigdyataaaavvltmsggkcvtasigltnvantplwaeeagkvlvgtaldk
    paldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakara