PDB entry 1n5z

View 1n5z on RCSB PDB site
Description: Complex structure of Pex13p SH3 domain with a peptide of Pex14p
Class: Protein transport
Keywords: SH3 domain, PxxP motif, Protein transport
Deposited on 2002-11-08, released 2002-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.246
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxisomal membrane protein pas20
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n5za_
  • Chain 'B':
    Compound: peroxisomal membrane protein pas20
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n5zb_
  • Chain 'P':
    Compound: 14-mer peptide from Peroxisomal membrane protein PEX14
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: 14-mer peptide from Peroxisomal membrane protein PEX14
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n5zA (A:)
    isefgsepidpsklefaralydfvpenpemevalkkgdlmailskkdplgrdsdwwkvrt
    kngnigyipynyieiikrrkkiehvddetrth
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n5zA (A:)
    epidpsklefaralydfvpenpemevalkkgdlmailskkdplgrdsdwwkvrtkngnig
    yipynyieiik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n5zB (B:)
    isefgsepidpsklefaralydfvpenpemevalkkgdlmailskkdplgrdsdwwkvrt
    kngnigyipynyieiikrrkkiehvddetrth
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n5zB (B:)
    psklefaralydfvpenpemevalkkgdlmailskkdplgrdsdwwkvrtkngnigyipy
    nyieiikrr
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.