PDB entry 1n5y

View 1n5y on RCSB PDB site
Description: HIV-1 Reverse Transcriptase Crosslinked to Post-Translocation AZTMP-Terminated DNA (Complex P)
Deposited on 2002-11-07, released 2003-01-28
The last revision prior to the SCOP 1.69 freeze date was dated 2003-01-28, with a file datestamp of 2003-01-28.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.255
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n5yA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndicklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagirk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n5yB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n5yB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyql
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n5yH (H:)
    qitlkesgpgivqpsqpfrltctfsgfslstsgigvtwirqpsgkglewlatiwwdddnr
    ynpslksrltvskdtsnnqaflnmmtvetadtaiyycaqsaitsvtdsamdhwgqgtsvt
    vssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpadc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n5yL (L:)
    diqmtqttsslsaslgdrvtiscsasqdissylnwyqqkpegtvklliyytsslhsgvps
    rfsgsgsgtdysltisnlepediatyycqqyskfpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr