PDB entry 1n5x

View 1n5x on RCSB PDB site
Description: Xanthine Dehydrogenase from Bovine Milk with Inhibitor TEI-6720 Bound
Class: oxidoreductase
Keywords: Oxidoreductase, Molybdopterin, TEI-6720, Flavoprotein, FAD, Iron-Sulfur Center, Fe2/S2 Center
Deposited on 2002-11-07, released 2003-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-08, with a file datestamp of 2013-05-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.244
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n5xA (A:)
    tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
    qdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgiv
    msmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfaknggccggngnnpnccm
    nqkkdhtvtlspslfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqast
    lkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfga
    acalssvektlleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisdl
    npvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysredeffsaf
    kqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkqlskfwnek
    llqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklgkdskdkcgkldpt
    ytsatllfqkhppaniqlfqevpngqskedtvgrplphlaaamqasgeavycddipryen
    elflrlvtstrahakiksidvseaqkvpgfvcflsaddipgsnetglfndetvfakdtvt
    cvghiigavvadtpehaeraahvvkvtyedlpaiitiedaiknnsfygselkiekgdlkk
    gfseadnvvsgelyiggqdhfylethctiaipkgeegemelfvstqnamktqsfvakmlg
    vpvnrilvrvkrmgggfggketrstlvsvavalaayktghpvrcmldrnedmlitggrhp
    flarykvgfmktgtivalevdhysnagnsrdlshsimeralfhmdncykipnirgtgrlc
    ktnlssntafrgfggpqalfiaenwmsevavtcglpaeevrwknmykegdlthfnqrleg
    fsvprcwdeclkssqyyarksevdkfnkencwkkrglciiptkfgisftvpflnqagali
    hvytdgsvlvshggtemgqglhtkmvqvaskalkipiskiyisetstntvpnssptaasv
    stdiygqavyeacqtilkrlepfkkknpdgswedwvmaayqdrvslsttgfyrtpnlgys
    fetnsgnafhyftygvacseveidcltgdhknlrtdivmdvgsslnpaidigqvegafvq
    glglftleelhyspegslhtrgpstykipafgsiptefrvsllrdcpnkkaiyaskavge
    pplflgasvffaikdairaaraqhtnnntkelfrldspatpekirnacvdkfttlcvtga
    pgnckpwslrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n5xA (A:)
    adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
    dkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgivm
    smytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfakspslfnpeefmpldptq
    epifppellrlkdvppkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiem
    kfknqlfpmiicpawipelnavehgpegisfgaacalssvektlleavaklptqktevfr
    gvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdht
    ffpsyrktllgpeeillsieipysredeffsafkqasrreddiakvtcgmrvlfqpgsmq
    vkelalcyggmadrtisalkttqkqlskfwnekllqdvcaglaeelslspdapggmiefr
    rtltlsfffkfyltvlkklgkdskldptytsatllfqkhppaniqlfqevpngqskedtv
    grplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpgfvc
    flsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtyedlp
    aiitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaip
    kgeegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvava
    laayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdl
    shsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavt
    cglpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencw
    kkrglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaska
    lkipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgsw
    edwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhkn
    lrtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafg
    siptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkel
    frldspatpekirnacvdkfttlkpwslrv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n5xB (B:)
    tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
    qdkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgiv
    msmytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfaknggccggngnnpnccm
    nqkkdhtvtlspslfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqast
    lkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfga
    acalssvektlleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisdl
    npvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysredeffsaf
    kqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkqlskfwnek
    llqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklgkdskdkcgkldpt
    ytsatllfqkhppaniqlfqevpngqskedtvgrplphlaaamqasgeavycddipryen
    elflrlvtstrahakiksidvseaqkvpgfvcflsaddipgsnetglfndetvfakdtvt
    cvghiigavvadtpehaeraahvvkvtyedlpaiitiedaiknnsfygselkiekgdlkk
    gfseadnvvsgelyiggqdhfylethctiaipkgeegemelfvstqnamktqsfvakmlg
    vpvnrilvrvkrmgggfggketrstlvsvavalaayktghpvrcmldrnedmlitggrhp
    flarykvgfmktgtivalevdhysnagnsrdlshsimeralfhmdncykipnirgtgrlc
    ktnlssntafrgfggpqalfiaenwmsevavtcglpaeevrwknmykegdlthfnqrleg
    fsvprcwdeclkssqyyarksevdkfnkencwkkrglciiptkfgisftvpflnqagali
    hvytdgsvlvshggtemgqglhtkmvqvaskalkipiskiyisetstntvpnssptaasv
    stdiygqavyeacqtilkrlepfkkknpdgswedwvmaayqdrvslsttgfyrtpnlgys
    fetnsgnafhyftygvacseveidcltgdhknlrtdivmdvgsslnpaidigqvegafvq
    glglftleelhyspegslhtrgpstykipafgsiptefrvsllrdcpnkkaiyaskavge
    pplflgasvffaikdairaaraqhtnnntkelfrldspatpekirnacvdkfttlcvtga
    pgnckpwslrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n5xB (B:)
    adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
    dkiihfsanaclapictlhhvavttvegigstktrlhpvqeriakshgsqcgfctpgivm
    smytllrnqpeptveeiedafqgnlcrctgyrpilqgfrtfakspslfnpeefmpldptq
    epifppellrlkdvppkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiem
    kfknqlfpmiicpawipelnavehgpegisfgaacalssvektlleavaklptqktevfr
    gvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdht
    ffpsyrktllgpeeillsieipysredeffsafkqasrreddiakvtcgmrvlfqpgsmq
    vkelalcyggmadrtisalkttqkqlskfwnekllqdvcaglaeelslspdapggmiefr
    rtltlsfffkfyltvlkklgkdskldptytsatllfqkhppaniqlfqevpngqskedtv
    grplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpgfvc
    flsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtyedlp
    aiitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaip
    kgeegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvava
    laayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdl
    shsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavt
    cglpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencw
    kkrglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaska
    lkipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgsw
    edwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhkn
    lrtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafg
    siptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkel
    frldspatpekirnacvdkfttlkpwslrv