PDB entry 1n5w

View 1n5w on RCSB PDB site
Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Oxidized form
Deposited on 2002-11-07, released 2002-12-23
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-23, with a file datestamp of 2002-12-23.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.135
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n5wA (A:)
    kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
    tmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqenps
    pteaeirfgiggnlcrctgyqnivkaiqyaaakingvpfee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n5wB (B:)
    tveptsaeraeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshaharik
    sidtskakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakd
    ryvaadaielvevdyeplpvlvdpfkamepdapllredikdkmtgahgarkhhnhifrwe
    igdkegtdatfakaevvskdmftyhrvhpspletcqcvasmdkikgeltlwgtfqaphvi
    rtvvslisglpehkihviapdigggfgnkvgaysgyvcavvasivlgvpvkwvedrmenl
    sttsfardyhmttelaatkdgkilamrchvladhgafdacadpskwpagfmnictgsydm
    pvahlavdgvytnkasggvayrcsfrvteavyaieraietlaqrlemdsadlriknfiqp
    eqfpymaplgweydsgnyplamkkamdtvgyhqlraeqkakqeafkrgetreimgigisf
    fteivgagpskncdilgvsmfdsaeirihptgsviarmgtksqgqghettyaqiiatelg
    ipaddimieegntdtapyglgtygsrstptagaatavaarkikakaqmiaahmlevhegd
    lewdvdrfrvkglpekfktmkelawasynspppnlepgleavnyydppnmtypfgayfci
    mdidvdtgvaktrrfyalddcgtrinpmiiegqvhgglteafavamgqeirydeqgnvlg
    asfmdfflptavetpkwetdytvtpsphhpigakgvgesphvggvpcfsnavndayafln
    aghiqmphdawrlwkvgeqlglhv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n5wC (C:)
    mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
    vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
    pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvpptghg
    yayeklkrkigdyataaaavvltmsggkcvtasigltnvantplwaeeagkvlvgtaldk
    paldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakarak
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n5wD (D:)
    kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
    tmfavqangasittiegmaapdgtlsalqegfrmmhglqcgyctpgmimrshrllqenps
    pteaeirfgiggnlcrctgyqnivkaiqyaaakingvp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n5wE (E:)
    aeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshahariksidtskaka
    lpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakdryvaadaie
    lvevdyeplpvlvdpfkamepdapllredikdkmtgahgarkhhnhifrweigdkegtda
    tfakaevvskdmftyhrvhpspletcqcvasmdkikgeltlwgtfqaphvirtvvslisg
    lpehkihviapdigggfgnkvgaysgyvcavvasivlgvpvkwvedrmenlsttsfardy
    hmttelaatkdgkilamrchvladhgafdacadpskwpagfmnictgsydmpvahlavdg
    vytnkasggvayrcsfrvteavyaieraietlaqrlemdsadlriknfiqpeqfpymapl
    gweydsgnyplamkkamdtvgyhqlraeqkakqeafkrgetreimgigisffteivgagp
    skncdilgvsmfdsaeirihptgsviarmgtksqgqghettyaqiiatelgipaddimie
    egntdtapyglgtygsrstptagaatavaarkikakaqmiaahmlevhegdlewdvdrfr
    vkglpekfktmkelawasynspppnlepgleavnyydppnmtypfgayfcimdidvdtgv
    aktrrfyalddcgtrinpmiiegqvhgglteafavamgqeirydeqgnvlgasfmdfflp
    tavetpkwetdytvtpsphhpigakgvgesphvggvpcfsnavndayaflnaghiqmphd
    awrlwkvgeqlglhv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n5wF (F:)
    mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
    vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
    pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvpptghg
    yayeklkrkigdyataaaavvltmsggkcvtasigltnvantplwaeeagkvlvgtaldk
    paldkavalaeaitapasdgrgpaeyrtkmagvmlrraverakara