PDB entry 1n5v

View 1n5v on RCSB PDB site
Description: Crystal structure of a Monooxygenase from the gene ActVA-Orf6 of Streptomyces coelicolor in complex with the ligand Nanaomycin D
Deposited on 2002-11-07, released 2003-01-14
The last revision prior to the SCOP 1.63 freeze date was dated 2003-01-14, with a file datestamp of 2003-01-14.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.214
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1n5va_
  • Chain 'B':
    Domains in SCOP 1.63: d1n5vb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1n5vA (A:)
aevndprvgfvavvtfpvdgpatqhklvelatggvqewirevpgflsatyhastdgtavv
nyaqweseqayrvnfgadprsaelrealsslpglmgppkavfmtprgailps

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1n5vB (B:)
aevndprvgfvavvtfpvdgpatqhklvelatggvqewirevpgflsatyhastdgtavv
nyaqweseqayrvnfgadprsaelrealsslpglmgppkavfmtprgailps