PDB entry 1n5t

View 1n5t on RCSB PDB site
Description: Crystal structure of a Monooxygenase from the gene ActVA-Orf6 of Streptomyces coelicolor in complex with the ligand Oxidized Acetyl Dithranol
Class: oxidoreductase
Keywords: monooxygenase, aromatic polyketides, actinorhodin, dihydrokalafungin, oxidized acetyl dithranol, streptomyces coelicolor
Deposited on 2002-11-07, released 2003-01-14
The last revision prior to the SCOP 1.75 freeze date was dated 2003-01-14, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: actva-orf6 monooxygenase
    Species: Streptomyces Coelicolor
    Gene: ActVA-Orf6
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1n5ta_
  • Chain 'B':
    Compound: actva-orf6 monooxygenase
    Species: Streptomyces Coelicolor
    Gene: ActVA-Orf6
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1n5tb_
  • Heterogens: OAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n5tA (A:)
    aevndprvgfvavvtfpvdgpatqhklvelatggvqewirevpgflsatyhastdgtavv
    nyaqweseqayrvnfgadprsaelrealsslpglmgppkavfmtprgailps
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n5tB (B:)
    aevndprvgfvavvtfpvdgpatqhklvelatggvqewirevpgflsatyhastdgtavv
    nyaqweseqayrvnfgadprsaelrealsslpglmgppkavfmtprgailps