PDB entry 1n5n

View 1n5n on RCSB PDB site
Description: Crystal Structure of Peptide Deformylase from Pseudomonas aeruginosa
Class: hydrolase
Keywords: metalloenzyme, drug design, deformylation, HYDROLASE
Deposited on 2002-11-06, released 2003-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide deformylase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I7A8 (12-End)
      • engineered (95)
    Domains in SCOPe 2.07: d1n5na_
  • Chain 'B':
    Compound: Peptide deformylase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I7A8
      • engineered (95)
    Domains in SCOPe 2.07: d1n5nb_
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n5nA (A:)
    mgsdkihhhhhhmailnilefpdprlrtiakpvevvddavrqliddmfetmyeapgigla
    atqvnvhkrivvmdlsedkseprvfinpefeplteemdqyqegclsvpgfyenvdrpqkv
    rikaldrdgnpfeevaegllavciqhecdhlngklfvdylstlkrdrirkklekqhrqqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n5nA (A:)
    mailnilefpdprlrtiakpvevvddavrqliddmfetmyeapgiglaatqvnvhkrivv
    mdlsedkseprvfinpefeplteemdqyqegclsvpgfyenvdrpqkvrikaldrdgnpf
    eevaegllavciqhecdhlngklfvdylstlkrdrirkklekqhrqq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n5nB (B:)
    mgsdkihhhhhhmailnilefpdprlrtiakpvevvddavrqliddmfetmyeapgigla
    atqvnvhkrivvmdlsedkseprvfinpefeplteemdqyqegclsvpgfyenvdrpqkv
    rikaldrdgnpfeevaegllavciqhecdhlngklfvdylstlkrdrirkklekqhrqqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n5nB (B:)
    ailnilefpdprlrtiakpvevvddavrqliddmfetmyeapgiglaatqvnvhkrivvm
    dlsedkseprvfinpefeplteemdqyqegclsvpgfyenvdrpqkvrikaldrdgnpfe
    evaegllavciqhecdhlngklfvdylstlkrdrirkklekqhr