PDB entry 1n55

View 1n55 on RCSB PDB site
Description: 0.83A resolution structure of the E65Q mutant of Leishmania mexicana triosephosphate isomerase complexed with 2-phosphoglycolate
Class: isomerase
Keywords: TIM, atomic resolution, enzyme-ligand complex, transition-state analogue, low-barrier hydrogen bond, ISOMERASE
Deposited on 2002-11-04, released 2003-01-21
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 0.83 Å
R-factor: 0.095
AEROSPACI score: 1.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Leishmania mexicana [TaxId:5665]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48499 (Start-250)
      • engineered (65)
    Domains in SCOPe 2.01: d1n55a_
  • Heterogens: PGA, ACY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n55A (A:)
    msakpqpiaaanwkcngttasieklvqvfnehtishdvqcvvaptfvhiplvqaklrnpk
    yvisaqnaiaksgaftgevsmpilkdigvhwvilghserrtyygetdeivaqkvseackq
    gfmviacigetlqqreanqtakvvlsqtsaiaakltkdawnqvvlayepvwaigtgkvat
    peqaqevhlllrkwvsenigtdvaaklrilyggsvnaanaatlyakpdingflvggaslk
    pefrdiidatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n55A (A:)
    akpqpiaaanwkcngttasieklvqvfnehtishdvqcvvaptfvhiplvqaklrnpkyv
    isaqnaiaksgaftgevsmpilkdigvhwvilghserrtyygetdeivaqkvseackqgf
    mviacigetlqqreanqtakvvlsqtsaiaakltkdawnqvvlayepvwaigtgkvatpe
    qaqevhlllrkwvsenigtdvaaklrilyggsvnaanaatlyakpdingflvggaslkpe
    frdiidatr