PDB entry 1n50

View 1n50 on RCSB PDB site
Description: following the c heme reduction in nitrite reductase from pseudomonas aeruginosa
Deposited on 1998-09-04, released 1999-06-15
The last revision prior to the SCOP 1.69 freeze date was dated 1999-06-15, with a file datestamp of 1999-06-14.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.208
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n50A (A:)
    kddmkaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatg
    kpltpditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewg
    mpemreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidtgya
    vhisrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyedryt
    iagaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivnvke
    tgkvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrrlsa
    lvdvgktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelqgqg
    ggslfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgegakr
    vvqpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyntqh
    dvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n50A (A:)
    aaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkpltp
    ditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewgmpemr
    eswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidtgyavhisr
    msasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyedrytiagay
    wppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivnvketgkvl
    lvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrrlsalvdvg
    ktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelqgqgggslf
    ikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgegakrvvqpe
    ynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyntqhdvy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n50B (B:)
    kddmkaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatg
    kpltpditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewg
    mpemreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidtgya
    vhisrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyedryt
    iagaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivnvke
    tgkvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrrlsa
    lvdvgktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelqgqg
    ggslfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgegakr
    vvqpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyntqh
    dvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n50B (B:)
    kaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkplt
    pditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewgmpem
    reswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidtgyavhis
    rmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyedrytiaga
    ywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivnvketgkv
    llvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrrlsalvdv
    gktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelqgqgggsl
    fikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgegakrvvqp
    eynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyntqhdvy