PDB entry 1n4t

View 1n4t on RCSB PDB site
Description: Solution structure of the catalytic domain from rat CNP
Class: hydrolase
Keywords: mixed alpha-beta, open beta-sheet structure
Deposited on 2002-11-01, released 2003-09-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2007-03-06, with a file datestamp of 2007-06-01.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2',3'-cyclic nucleotide 3'-phosphodiesterase
    Species: Rattus norvegicus
    Gene: CNP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13233 (4-218)
      • cloning artifact (0-3)
    Domains in SCOPe 2.06: d1n4ta1, d1n4ta2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1n4tA (A:)
gshmflplyfgwfltkkssetlrkagqvfleelgnhkafkkelrhfisgdepkekldlvs
yfgkrppgvlhcttkfcdygkatgaeeyaqqdvvrrsygkafklsisalfvtpktagaqv
vlneqelqlwpsdldkpssseslppgsrahvtlgcaadvqpvqtgldlleilqqvkggsq
geevgelprgklyslgkgrwmlslakkmevkaiftgyyg