PDB entry 1n4r

View 1n4r on RCSB PDB site
Description: Protein Geranylgeranyltransferase type-I Complexed with a Geranylgeranylated KKKSKTKCVIL Peptide Product
Class: transferase
Keywords: protein geranylgeranyltransferase type-I, GGTase, geranylgeranyl, protein prenylation, CaaX, lipid modification, rap2b, TRANSFERASE
Deposited on 2002-11-01, released 2003-11-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n4ra_
  • Chain 'B':
    Compound: Geranylgeranyl transferase type-1 subunit beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n4rb_
  • Chain 'C':
    Compound: Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n4rc_
  • Chain 'D':
    Compound: Geranylgeranyl transferase type-1 subunit beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n4rd_
  • Chain 'E':
    Compound: Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n4re_
  • Chain 'F':
    Compound: Geranylgeranyl transferase type-1 subunit beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n4rf_
  • Chain 'G':
    Compound: Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n4rg_
  • Chain 'H':
    Compound: Geranylgeranyl transferase type-1 subunit beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n4rh_
  • Chain 'I':
    Compound: Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n4ri_
  • Chain 'J':
    Compound: Geranylgeranyl transferase type-1 subunit beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n4rj_
  • Chain 'K':
    Compound: Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Fnta
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n4rk_
  • Chain 'L':
    Compound: Geranylgeranyl transferase type-1 subunit beta
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PGGT1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1n4rl_
  • Chain 'M':
    Compound: Fusion protein consisting of transforming protein p21b and Ras related protein Rap-2b
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1N4R
  • Chain 'N':
    Compound: Fusion protein consisting of transforming protein p21b and Ras related protein Rap-2b
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1N4R
  • Chain 'O':
    Compound: Fusion protein consisting of transforming protein p21b and Ras related protein Rap-2b
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1N4R
  • Chain 'P':
    Compound: Fusion protein consisting of transforming protein p21b and Ras related protein Rap-2b
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1N4R
  • Chain 'Q':
    Compound: Fusion protein consisting of transforming protein p21b and Ras related protein Rap-2b
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1N4R
  • Chain 'R':
    Compound: Fusion protein consisting of transforming protein p21b and Ras related protein Rap-2b
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1N4R (Start-10)
  • Heterogens: MES, ZN, SO4, CL, GER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n4rA (A:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4rA (A:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n4rB (B:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4rB (B:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n4rC (C:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4rC (C:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n4rD (D:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4rD (D:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1n4rE (E:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4rE (E:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1n4rF (F:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4rF (F:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1n4rG (G:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4rG (G:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1n4rH (H:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4rH (H:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1n4rI (I:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4rI (I:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1n4rJ (J:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4rJ (J:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1n4rK (K:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4rK (K:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1n4rL (L:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4rL (L:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.