PDB entry 1n4p

View 1n4p on RCSB PDB site
Description: Protein Geranylgeranyltransferase type-I Complexed with Geranylgeranyl Diphosphate
Class: transferase
Keywords: protein geranylgeranyltransferase type-I, GGTase, geranylgeranyl, protein prenylation, CaaX, lipid modification, rap2b
Deposited on 2002-11-01, released 2003-11-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-05-12, with a file datestamp of 2009-05-08.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.204
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein farnesyltransferase alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n4pa_
  • Chain 'B':
    Compound: geranyltransferase type-I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n4pb_
  • Chain 'C':
    Compound: protein farnesyltransferase alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n4pc_
  • Chain 'D':
    Compound: geranyltransferase type-I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n4pd_
  • Chain 'E':
    Compound: protein farnesyltransferase alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n4pe_
  • Chain 'F':
    Compound: geranyltransferase type-I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n4pf_
  • Chain 'G':
    Compound: protein farnesyltransferase alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n4pg_
  • Chain 'H':
    Compound: geranyltransferase type-I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n4ph_
  • Chain 'I':
    Compound: protein farnesyltransferase alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n4pi_
  • Chain 'J':
    Compound: geranyltransferase type-I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n4pj_
  • Chain 'K':
    Compound: protein farnesyltransferase alpha subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n4pk_
  • Chain 'L':
    Compound: geranyltransferase type-I beta subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1n4pl_
  • Chain 'M':
    Compound: Fusion protein consisting of transforming protein p21b and Ras related protein Rap-2b
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: Fusion protein consisting of transforming protein p21b and Ras related protein Rap-2b
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, CL, GRG, GER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n4pA (A:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4pA (A:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1n4pB (B:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4pB (B:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n4pC (C:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4pC (C:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1n4pD (D:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4pD (D:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1n4pE (E:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4pE (E:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1n4pF (F:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4pF (F:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1n4pG (G:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4pG (G:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1n4pH (H:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4pH (H:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1n4pI (I:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4pI (I:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1n4pJ (J:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4pJ (J:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1n4pK (K:)
    maategvgesapggepgqpeqpppppppppaqqpqeeemaaeageaaaspmddgflslds
    ptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderserafklt
    rdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrvlvewlk
    dpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnnsvwnqr
    hfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypnllnqll
    dlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirkeywryig
    rslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4pK (K:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqskhs
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1n4pL (L:)
    maateddrlagsgegerldflrdrhvrffqrclqvlperyssletsrltiaffalsgldm
    ldsldvvnkddiiewiyslqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsg
    hiamtytglscliilgddlsrvdkeaclaglralqledgsfcavpegsendmrfvycasc
    icymlnnwsgmdmkkaisyirrsmsydnglaqgagleshggstfcgiaslclmgkleevf
    sekelnrikrwcimrqqngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyils
    tqdrlvggfakwpdshpdalhayfgicglslmeesgickvhpalnvstrtserlrdlhqs
    wktkdskqcsdnvhiss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n4pL (L:)
    ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
    slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
    dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
    syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
    ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
    dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.