PDB entry 1n4n

View 1n4n on RCSB PDB site
Description: Structure of the Plant Defensin PhD1 from Petunia Hybrida
Class: Plant protein
Keywords: Cysteine-stabilised alpha-beta motif, fifth disulfide bond, Plant protein
Deposited on 2002-11-01, released 2003-11-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: floral defensin-like protein 1
  Species: Petunia x hybrida [TaxId:4102]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8H6Q1 (0-46)
  Domains in SCOPe 2.04: d1n4na_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1n4nA (A:)
  atckaecptwdsvcinkkpcvacckkakfsdghcskilrrclctkec